H00023016-M01

EXOSC7 antibody from Abnova Corporation
EAP1, hRrp42p, KIAA0116, p8, RRP42, Rrp42p

Antibody data

Product number
H00023016-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023016-M01, RRID:AB_1137197
Product name
EXOSC7 monoclonal antibody (M01), clone 2F10
Provider product page
Abnova Corporation - H00023016-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EXOSC7.
Antigen sequence
LSVENVPCIVTLCKIGYRHVVDATLQEEACSLASL
LVSVTSKGVVTCMRKVGKGSLDPESIFEMMETGKR
VGKVLHASLQSVLHKEESLGPKRQKVGFLG
Isotype
IgG
Antibody clone number
2F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -