ABIN184033

EXOSC7 antibody from antibodies-online
EAP1, hRrp42p, KIAA0116, p8, RRP42, Rrp42p
Western blot
Data presented on provider website
Immunohistochemistry
Recommended by provider

Antibody data

Product number
ABIN184033
Provider
antibodies-online
Product name
anti-Exosome Component 7 (EXOSC7) (N-Term) antibody
Provider product page
antibodies-online - ABIN184033
Antibody type
Polyclonal
Antigen
The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEI
ANTLY RIFNNKSSVD
Epitope
N-Term
Vial size (┬Ál)
100 μg
Concentration (mg/ml)
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -