AV40796

EXOSC7 antibody from Sigma-Aldrich
EAP1, hRrp42p, KIAA0116, p8, RRP42, Rrp42p
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV40796
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV40796, RRID:AB_1848328
Product name
Anti-EXOSC7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV40796
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human EXOSC7 with an internal ID of Y01048
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
EKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIA
NTLYRIFNNKSSVDL
Storage
-20C
Provider Type Product Number
- No reagents -