HPA002532

C10orf2 antibody from Sigma-Aldrich
FLJ21832, IOSCA, PEO, PEO1, TWINKLE, TWINL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002532
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002532, RRID:AB_1078311
Product name
Anti-PEO1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002532
Antibody type
Polyclonal
Antigen
Twinkle protein, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKAPEFEDSEEVRRIWNRAIPLWELPDQEEVQLAD
TMFGLTKVTDDTLKRFSVRYLRPARSLVFPWFSPG
GSGLRGLKLLEAKCQGDGVSYEETTIPRPSAYHNL
FGLPLISRRDAEVVLTSRELDSLALNQSTG
Storage
-20C
Provider Type Product Number
- No reagents -