H00056652-M03

TWNK antibody from Abnova Corporation
C10orf2, FLJ21832, IOSCA, PEO, PEO1, TWINKLE, TWINL
No application information provided.

Antibody data

Product number
H00056652-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056652-M03, RRID:AB_1578617
Product name
PEO1 monoclonal antibody (M03), clone 1C5
Provider product page
Abnova Corporation - H00056652-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PEO1.
Antigen sequence
DRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNS
LTFSIPPKNKARLKKIKDDTGPVAKKPSSGKKGAT
TQNSEICSGQAPTPDQPDTSKRSK
Isotype
IgG
Antibody clone number
1C5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -