HPA020735

GGCT antibody from Atlas Antibodies
C7orf24, CRF21, GCTG, Ggc, MGC3077
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020735
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020735, RRID:AB_1845754
Product name
Anti-GGCT
Provider product page
Atlas Antibodies - HPA020735
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYE
SAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPN
DYTGKVSEEIE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -