Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029914 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029914, RRID:AB_10602321
- Product name
- Anti-GGCT
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPS
AAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIF
QSPGDEVWGVVWKMNKSNLNSLDE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Widespread expression of γ-glutamyl cyclotransferase suggests it is not a general tumor marker.
Proteomic Profiling of Mammary Carcinomas Identifies C7orf24, a γ-Glutamyl Cyclotransferase, as a Potential Cancer Biomarker
Amano T, Eishi Y, Yamada T, Uchida K, Minegishi K, Tamura T, Kobayashi D, Hiroshi K, Suzuki T, Board PG
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2012 Jan;60(1):76-86
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2012 Jan;60(1):76-86
Proteomic Profiling of Mammary Carcinomas Identifies C7orf24, a γ-Glutamyl Cyclotransferase, as a Potential Cancer Biomarker
Gromov P, Gromova I, Friis E, Timmermans-Wielenga V, Rank F, Simon R, Sauter G, Moreira J
Journal of Proteome Research 2010 August;9(8):3941-3953
Journal of Proteome Research 2010 August;9(8):3941-3953
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human corpus, uterine shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN