HPA020735

GGCT antibody from Sigma-Aldrich
C7orf24, CRF21, GCTG, Ggc, MGC3077
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020735
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020735, RRID:AB_1845754
Product name
Anti-GGCT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020735
Antibody type
Polyclonal
Antigen
Gamma-glutamylcyclotransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYE
SAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPN
DYTGKVSEEIE
Storage
-20C
Provider Type Product Number
- No reagents -