Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004722-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004722-M02, RRID:AB_534955
- Product name
- NDUFS3 monoclonal antibody (M02), clone 1D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant NDUFS3.
- Antigen sequence
MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVR
RESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILP
KYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTN
AQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSR
IRVKTYTDELTPIESAVSVFKAANWYEREIWDMFG
VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEL
RYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVY
RQPPESLKLEAGDKKPDAK- Isotype
- IgG
- Antibody clone number
- 1D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Overexpression of Lon contributes to survival and aggressive phenotype of cancer cells through mitochondrial complex I-mediated generation of reactive oxygen species.
Cheng CW, Kuo CY, Fan CC, Fang WC, Jiang SS, Lo YK, Wang TY, Kao MC, Lee AY
Cell death & disease 2013 Jun 20;4:e681
Cell death & disease 2013 Jun 20;4:e681
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NDUFS3 expression in transfected 293T cell line by NDUFS3 monoclonal antibody (M02), clone 1D6.Lane 1: NDUFS3 transfected lysate(30.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of NDUFS3 transfected lysate using anti-NDUFS3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NDUFS3 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to NDUFS3 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol