Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504011 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-NADH Dehydrogenase (Ubiquinone) Fe-S Protein 3, 30kDa (NADH-Coenzyme Q Reductase) (NDUFS3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPP
ESLKL EAGDKKPDAK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of mitochondrial complex I assembly intermediates by tracing tagged NDUFS3 demonstrates the entry point of mitochondrial subunits.
Vogel RO, Dieteren CE, van den Heuvel LP, Willems PH, Smeitink JA, Koopman WJ, Nijtmans LG
The Journal of biological chemistry 2007 Mar 9;282(10):7582-90
The Journal of biological chemistry 2007 Mar 9;282(10):7582-90
No comments: Submit comment
No validations: Submit validation data