HPA004484

NDUFS3 antibody from Sigma-Aldrich
CI-30
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004484
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004484, RRID:AB_1079464
Product name
Anti-NDUFS3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004484
Antibody type
Polyclonal
Antigen
Protein-tyrosine phosphatase mitochondrial 1, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTN
AQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSR
IRVKTYTDELTPIESAVSVFKAANWYEREIWDMFG
VFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEL
RYDDEVK
Storage
-20C
Provider Type Product Number
- No reagents -