HPA018845

TOMM34 antibody from Sigma-Aldrich
HTOM34P, TOM34
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018845
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018845, RRID:AB_1858184
Product name
Anti-TOMM34 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018845
Antibody type
Polyclonal
Antigen
Mitochondrial import receptor subunit TOM34 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQ
AHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEV
KQNL
Storage
-20C
Provider Type Product Number
- No reagents -