HPA018524

NDUFS8 antibody from Sigma-Aldrich
CI-23k, TYKY
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018524
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018524, RRID:AB_1854355
Product name
Anti-NDUFS8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018524
Antibody type
Polyclonal
Antigen
NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRG
LGMTLSYLFREPATINYPFEKGPLSPRFRGEHALR
RYPSGEERCIACKLCEAICPAQAITIEAEPRADGS
RRTTRYDIDMTKCIYC
Storage
-20C
Provider Type Product Number
- No reagents -