HPA023164

MFSD6L antibody from Atlas Antibodies
FLJ35773
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023164
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023164, RRID:AB_2142777
Product name
Anti-MFSD6L
Provider product page
Atlas Antibodies - HPA023164
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NRVHFPCNGSSGLTSTDALPGVTLPVNITSAQESA
SSHPAKRTAEVEMPGFRNPPGESDRETFRDLHVYL
APSVEGARTTS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -