HPA023164

MFSD6L antibody from Sigma-Aldrich
FLJ35773
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023164
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023164, RRID:AB_2142777
Product name
Anti-MFSD6L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023164
Antibody type
Polyclonal
Antigen
Major facilitator superfamily domain-containing protein 6-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NRVHFPCNGSSGLTSTDALPGVTLPVNITSAQESA
SSHPAKRTAEVEMPGFRNPPGESDRETFRDLHVYL
APSVEGARTTS
Storage
-20C
Provider Type Product Number
- No reagents -