Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA053229 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA053229, RRID:AB_2682084
- Product name
- Anti-PLK1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMS
MEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCR
RRSLLELHKRRKALTEP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A Gene Co-Expression Network-Based Drug Repositioning Approach Identifies Candidates for Treatment of Hepatocellular Carcinoma
Identification of Rigosertib for the Treatment of Recessive Dystrophic Epidermolysis Bullosa–Associated Squamous Cell Carcinoma
Yuan M, Shong K, Li X, Ashraf S, Shi M, Kim W, Nielsen J, Turkez H, Shoaie S, Uhlen M, Zhang C, Mardinoglu A
Cancers 2022;14(6):1573
Cancers 2022;14(6):1573
Identification of Rigosertib for the Treatment of Recessive Dystrophic Epidermolysis Bullosa–Associated Squamous Cell Carcinoma
Atanasova V, Pourreyron C, Farshchian M, Lawler M, Brown C, Watt S, Wright S, Warkala M, Guttmann-Gruber C, Hofbauer J, Fuentes I, Prisco M, Rashidghamat E, Has C, Salas-Alanis J, Palisson F, Hovnanian A, McGrath J, Mellerio J, Bauer J, South A
Clinical Cancer Research 2019;25(11):3384-3391
Clinical Cancer Research 2019;25(11):3384-3391
No comments: Submit comment
No validations: Submit validation data