HPA026495

RMDN1 antibody from Atlas Antibodies
CGI-90, FAM82B, FLJ20665, RMD1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026495
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026495, RRID:AB_1848414
Product name
Anti-RMDN1
Provider product page
Atlas Antibodies - HPA026495
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLARASRDVAQLSRTSEEEKKLLVYEALEYAKRAL
EKNESSFASHKWYAICLSDVGDYEGIKAKIANAYI
IKEHFEKAIELNPKDATSIHL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -