PAB28261

RMDN1 antibody from Abnova Corporation
CGI-90, FAM82B, FLJ20665, RMD1

Antibody data

Product number
PAB28261
Provider
Abnova Corporation
Product name
FAM82B polyclonal antibody
Provider product page
Abnova Corporation - PAB28261
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FAM82B.
Antigen sequence
RLARASRDVAQLSRTSEEEKKLLVYEALEYAKRAL
EKNESSFASHKWYAICLSDVGDYEGIKAKIANAYI
IKEHFEKAIELNPKDATSIHL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.