HPA026495

RMDN1 antibody from MilliporeSigma / Merck KGaA
CGI-90, FAM82B, FLJ20665, RMD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026495
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026495, RRID:AB_1848414
Product name
Anti-FAM82B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026495
Antibody type
Polyclonal
Antigen
Regulator of microtubule dynamics protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLARASRDVAQLSRTSEEEKKLLVYEALEYAKRAL
EKNESSFASHKWYAICLSDVGDYEGIKAKIANAYI
IKEHFEKAIELNPKDATSIHL
Storage
-20C
Provider Type Product Number
- No reagents -