Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28696 - Provider product page

- Provider
- Abnova Corporation
- Product name
- SDHB polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant SDHB, subunit B.
- Antigen sequence
EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSY
WWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKL
QDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKM
MATY- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot anaylsis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with SDHB polyclonal antibody (Cat # PAB28696) at 1:100-1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver with SDHB polyclonal antibody (Cat # PAB28696) shows strong cytoplasmic positivity in hepatocytes at 1:500-1:1000 dilution.
- Validation comment
- Immunohistochemistry