Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405954 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCT
RTCPK GLNPGKAIAE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Spatial distribution of cellular function: the partitioning of proteins between mitochondria and the nucleus in MCF7 breast cancer cells.
Molecular characterisation of a common SDHB deletion in paraganglioma patients.
Qattan AT, Radulovic M, Crawford M, Godovac-Zimmermann J
Journal of proteome research 2012 Dec 7;11(12):6080-101
Journal of proteome research 2012 Dec 7;11(12):6080-101
Molecular characterisation of a common SDHB deletion in paraganglioma patients.
Cascón A, Landa I, López-Jiménez E, Díez-Hernández A, Buchta M, Montero-Conde C, Leskelä S, Leandro-García LJ, Letón R, Rodríguez-Antona C, Eng C, Neumann HP, Robledo M
Journal of medical genetics 2008 Apr;45(4):233-8
Journal of medical genetics 2008 Apr;45(4):233-8
No comments: Submit comment
No validations: Submit validation data