HPA002868

SDHB antibody from Atlas Antibodies
SDH, SDH1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA002868
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002868, RRID:AB_888923
Product name
Anti-SDHB
Provider product page
Atlas Antibodies - HPA002868
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSY
WWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKL
QDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKM
MATY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -