Antibody data
- Antibody Data
- Antigen structure
- References [15]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002868 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002868, RRID:AB_1079889
- Product name
- Anti-SDHB
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSY
WWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKL
QDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKM
MATY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references SDHB/SDHA immunohistochemistry in pheochromocytomas and paragangliomas: a multicenter interobserver variation analysis using virtual microscopy: a Multinational Study of the European Network for the Study of Adrenal Tumors (ENS@T)
C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization.
Integrated genomic study of quadruple-WT GIST (KIT/PDGFRA/SDH/RAS pathway wild-type GIST).
Paraganglioma and pheochromocytoma upon maternal transmission of SDHD mutations.
Analysis of all subunits, SDHA, SDHB, SDHC, SDHD, of the succinate dehydrogenase complex in KIT/PDGFRA wild-type GIST.
A MEN1 syndrome with a paraganglioma.
Tyrosine kinase receptors as molecular targets in pheochromocytomas and paragangliomas.
Mitochondrial function and content in pheochromocytoma/paraganglioma of succinate dehydrogenase mutation carriers
Succinate dehydrogenase (SDH) D subunit (SDHD) inactivation in a growth-hormone-producing pituitary tumor: a new association for SDH?
SDHB immunohistochemistry: a useful tool in the diagnosis of Carney-Stratakis and Carney triad gastrointestinal stromal tumors.
Sumo1-ylation of human spermatozoa and its relationship with semen quality
A non-catecholamine-producing sympathetic paraganglioma of the spermatic cord: the importance of performing candidate gene mutation analysis.
SDHA is a tumor suppressor gene causing paraganglioma.
The Warburg effect is genetically determined in inherited pheochromocytomas.
An immunohistochemical procedure to detect patients with paraganglioma and phaeochromocytoma with germline SDHB, SDHC, or SDHD gene mutations: a retrospective and prospective analysis.
Papathomas T, Oudijk L, Persu A, Gill A, van Nederveen F, Tischler A, Tissier F, Volante M, Matias-Guiu X, Smid M, Favier J, Rapizzi E, Libe R, Currás-Freixes M, Aydin S, Huynh T, Lichtenauer U, van Berkel A, Canu L, Domingues R, Clifton-Bligh R, Bialas M, Vikkula M, Baretton G, Papotti M, Nesi G, Badoual C, Pacak K, Eisenhofer G, Timmers H, Beuschlein F, Bertherat J, Mannelli M, Robledo M, Gimenez-Roqueplo A, Dinjens W, Korpershoek E, de Krijger R
Modern Pathology 2015 February;28(6):807-821
Modern Pathology 2015 February;28(6):807-821
C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization.
Desmurs M, Foti M, Raemy E, Vaz FM, Martinou JC, Bairoch A, Lane L
Molecular and cellular biology 2015 Apr;35(7):1139-56
Molecular and cellular biology 2015 Apr;35(7):1139-56
Integrated genomic study of quadruple-WT GIST (KIT/PDGFRA/SDH/RAS pathway wild-type GIST).
Nannini M, Astolfi A, Urbini M, Indio V, Santini D, Heinrich MC, Corless CL, Ceccarelli C, Saponara M, Mandrioli A, Lolli C, Ercolani G, Brandi G, Biasco G, Pantaleo MA
BMC cancer 2014 Sep 20;14:685
BMC cancer 2014 Sep 20;14:685
Paraganglioma and pheochromocytoma upon maternal transmission of SDHD mutations.
Bayley JP, Oldenburg RA, Nuk J, Hoekstra AS, van der Meer CA, Korpershoek E, McGillivray B, Corssmit EP, Dinjens WN, de Krijger RR, Devilee P, Jansen JC, Hes FJ
BMC medical genetics 2014 Oct 10;15:111
BMC medical genetics 2014 Oct 10;15:111
Analysis of all subunits, SDHA, SDHB, SDHC, SDHD, of the succinate dehydrogenase complex in KIT/PDGFRA wild-type GIST.
Pantaleo MA, Astolfi A, Urbini M, Nannini M, Paterini P, Indio V, Saponara M, Formica S, Ceccarelli C, Casadio R, Rossi G, Bertolini F, Santini D, Pirini MG, Fiorentino M, Basso U, Biasco G, GIST Study Group
European journal of human genetics : EJHG 2014 Jan;22(1):32-9
European journal of human genetics : EJHG 2014 Jan;22(1):32-9
A MEN1 syndrome with a paraganglioma.
Jamilloux Y, Favier J, Pertuit M, Delage-Corre M, Lopez S, Teissier MP, Mathonnet M, Galinat S, Barlier A, Archambeaud F
European journal of human genetics : EJHG 2014 Feb;22(2):283-5
European journal of human genetics : EJHG 2014 Feb;22(2):283-5
Tyrosine kinase receptors as molecular targets in pheochromocytomas and paragangliomas.
Cassol CA, Winer D, Liu W, Guo M, Ezzat S, Asa SL
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2014 Aug;27(8):1050-62
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2014 Aug;27(8):1050-62
Mitochondrial function and content in pheochromocytoma/paraganglioma of succinate dehydrogenase mutation carriers
Rapizzi E, Ercolino T, Canu L, Giache V, Francalanci M, Pratesi C, Valeri A, Mannelli M
Endocrine Related Cancer 2012 May;19(3):261-269
Endocrine Related Cancer 2012 May;19(3):261-269
Succinate dehydrogenase (SDH) D subunit (SDHD) inactivation in a growth-hormone-producing pituitary tumor: a new association for SDH?
Xekouki P, Pacak K, Almeida M, Wassif CA, Rustin P, Nesterova M, de la Luz Sierra M, Matro J, Ball E, Azevedo M, Horvath A, Lyssikatos C, Quezado M, Patronas N, Ferrando B, Pasini B, Lytras A, Tolis G, Stratakis CA
The Journal of clinical endocrinology and metabolism 2012 Mar;97(3):E357-66
The Journal of clinical endocrinology and metabolism 2012 Mar;97(3):E357-66
SDHB immunohistochemistry: a useful tool in the diagnosis of Carney-Stratakis and Carney triad gastrointestinal stromal tumors.
Gaal J, Stratakis CA, Carney JA, Ball ER, Korpershoek E, Lodish MB, Levy I, Xekouki P, van Nederveen FH, den Bakker MA, O'Sullivan M, Dinjens WN, de Krijger RR
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2011 Jan;24(1):147-51
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2011 Jan;24(1):147-51
Sumo1-ylation of human spermatozoa and its relationship with semen quality
Marchiani S, Tamburrino L, Giuliano L, Nosi D, Sarli V, Gandini L, Piomboni P, Belmonte G, Forti G, Baldi E, Muratori M
International Journal of Andrology 2011 December;34(6pt1):581-593
International Journal of Andrology 2011 December;34(6pt1):581-593
A non-catecholamine-producing sympathetic paraganglioma of the spermatic cord: the importance of performing candidate gene mutation analysis.
Alataki D, Triantafyllidis A, Gaal J, Rodiou C, Vouros J, Papathanasiou A, Papanicolaou A, Rombis V, de Krijger RR
Virchows Archiv : an international journal of pathology 2010 Nov;457(5):619-22
Virchows Archiv : an international journal of pathology 2010 Nov;457(5):619-22
SDHA is a tumor suppressor gene causing paraganglioma.
Burnichon N, Brière JJ, Libé R, Vescovo L, Rivière J, Tissier F, Jouanno E, Jeunemaitre X, Bénit P, Tzagoloff A, Rustin P, Bertherat J, Favier J, Gimenez-Roqueplo AP
Human molecular genetics 2010 Aug 1;19(15):3011-20
Human molecular genetics 2010 Aug 1;19(15):3011-20
The Warburg effect is genetically determined in inherited pheochromocytomas.
Favier J, Brière JJ, Burnichon N, Rivière J, Vescovo L, Benit P, Giscos-Douriez I, De Reyniès A, Bertherat J, Badoual C, Tissier F, Amar L, Libé R, Plouin PF, Jeunemaitre X, Rustin P, Gimenez-Roqueplo AP
PloS one 2009 Sep 18;4(9):e7094
PloS one 2009 Sep 18;4(9):e7094
An immunohistochemical procedure to detect patients with paraganglioma and phaeochromocytoma with germline SDHB, SDHC, or SDHD gene mutations: a retrospective and prospective analysis.
van Nederveen FH, Gaal J, Favier J, Korpershoek E, Oldenburg RA, de Bruyn EM, Sleddens HF, Derkx P, Rivière J, Dannenberg H, Petri BJ, Komminoth P, Pacak K, Hop WC, Pollard PJ, Mannelli M, Bayley JP, Perren A, Niemann S, Verhofstad AA, de Bruïne AP, Maher ER, Tissier F, Méatchi T, Badoual C, Bertherat J, Amar L, Alataki D, Van Marck E, Ferrau F, François J, de Herder WW, Peeters MP, van Linge A, Lenders JW, Gimenez-Roqueplo AP, de Krijger RR, Dinjens WN
The Lancet. Oncology 2009 Aug;10(8):764-71
The Lancet. Oncology 2009 Aug;10(8):764-71
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SDHB antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm, plasma membrane & mitochondria.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows moderate to strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
- Sample type
- HUMAN