HPA016558

ERN2 antibody from Sigma-Aldrich
IRE1b
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016558
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016558, RRID:AB_1848250
Product name
Anti-ERN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016558
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase/endoribonuclease IRE2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPGKYMSHLASCGMGLLLTVDPGSGTVLWTQDLGV
PVMGVYTWHQDGLRQLPHLTLARDTLHFLALRWGH
IRLPASGPRDTATLFSTLDTQLLMTLYVGKDETGF
YVSKALVHTGVALVPRGLTLAPADGPTT
Storage
-20C
Provider Type Product Number
- No reagents -