Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002620-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002620-M01, RRID:AB_565760
- Product name
- GAS2 monoclonal antibody (M01), clone 4E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GAS2.
- Antigen sequence
MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLP
MKEDLALWLTNLLGKEITAETFMEKLDNGALLCQL
AETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSG
SFFAR- Isotype
- IgG
- Antibody clone number
- 4E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references p53-dependent translational control of senescence and transformation via 4E-BPs.
Petroulakis E, Parsyan A, Dowling RJ, LeBacquer O, Martineau Y, Bidinosti M, Larsson O, Alain T, Rong L, Mamane Y, Paquet M, Furic L, Topisirovic I, Shahbazian D, Livingstone M, Costa-Mattioli M, Teodoro JG, Sonenberg N
Cancer cell 2009 Nov 6;16(5):439-46
Cancer cell 2009 Nov 6;16(5):439-46
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GAS2 monoclonal antibody (M01), clone 4E11 Western Blot analysis of GAS2 expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GAS2 expression in transfected 293T cell line by GAS2 monoclonal antibody (M01), clone 4E11.Lane 1: GAS2 transfected lysate(34.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GAS2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to GAS2 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol