Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002620-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002620-A01, RRID:AB_462764
- Product name
- GAS2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant GAS2.
- Antigen sequence
MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLP
MKEDLALWLTNLLGKEITAETFMEKLDNGALLCQL
AETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSG
SFFAR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Gene silencing in cancer by histone H3 lysine 27 trimethylation independent of promoter DNA methylation.
Kondo Y, Shen L, Cheng AS, Ahmed S, Boumber Y, Charo C, Yamochi T, Urano T, Furukawa K, Kwabi-Addo B, Gold DL, Sekido Y, Huang TH, Issa JP
Nature genetics 2008 Jun;40(6):741-50
Nature genetics 2008 Jun;40(6):741-50
No comments: Submit comment
No validations: Submit validation data