Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010454-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010454-M03, RRID:AB_565926
- Product name
- MAP3K7IP1 monoclonal antibody (M03), clone 2A12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAP3K7IP1.
- Antigen sequence
AQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSY
SADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYD
GNRVTNFVAQRLSAELLLGQLNAEHAEA- Isotype
- IgG
- Antibody clone number
- 2A12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MAP3K7IP1 monoclonal antibody (M03), clone 2A12. Western Blot analysis of MAP3K7IP1 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MAP3K7IP1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MAP3K7IP1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between HSPA1L and MAP3K7IP1. HeLa cells were stained with anti-HSPA1L rabbit purified polyclonal 1:1200 and anti-MAP3K7IP1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)