Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310160 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Betaine--Homocysteine S-Methyltransferase (BHMT) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKL
ENRGN YVLEKISGQE- Vial size
- 0.1 mg
Submitted references Long-term betaine therapy in a murine model of cystathionine beta-synthase deficient homocystinuria: decreased efficacy over time reveals a significant threshold effect between elevated homocysteine and thrombotic risk.
Dissecting the catalytic mechanism of betaine-homocysteine S-methyltransferase by use of intrinsic tryptophan fluorescence and site-directed mutagenesis.
Maclean KN, Jiang H, Greiner LS, Allen RH, Stabler SP
Molecular genetics and metabolism 2012 Mar;105(3):395-403
Molecular genetics and metabolism 2012 Mar;105(3):395-403
Dissecting the catalytic mechanism of betaine-homocysteine S-methyltransferase by use of intrinsic tryptophan fluorescence and site-directed mutagenesis.
Castro C, Gratson AA, Evans JC, Jiracek J, Collinsová M, Ludwig ML, Garrow TA
Biochemistry 2004 May 11;43(18):5341-51
Biochemistry 2004 May 11;43(18):5341-51
No comments: Submit comment
No validations: Submit validation data