HPA023247

CFAP52 antibody from Atlas Antibodies
FLJ37528, WDR16, WDRPUH
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023247
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023247, RRID:AB_1858797
Product name
Anti-CFAP52
Provider product page
Atlas Antibodies - HPA023247
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVS
AIRCLKMGGLLVGSGAGLLVFCKSPGYKPIKKIQL
QGGITSITLRGEGHQFLVGTEESH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -