Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007998 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007998, RRID:AB_1858648
- Product name
- Anti-UQCRC2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKI
TRGIEAVGGKLSVTATRENMAYTVECLRGDVDILM
EFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNP
QTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEE
LHYFVQN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Localization of HPV-18 E2 at mitochondrial membranes induces ROS release and modulates host cell metabolism.
Lai D, Tan CL, Gunaratne J, Quek LS, Nei W, Thierry F, Bellanger S
PloS one 2013;8(9):e75625
PloS one 2013;8(9):e75625
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-UQCRC2 antibody HPA007998 (A) shows similar pattern to independent antibody HPA019146 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
- Sample type
- HUMAN
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human heart muscle and pancreas tissues using Anti-UQCRC2 antibody. Corresponding UQCRC2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, heart muscle, liver and pancreas using Anti-UQCRC2 antibody HPA007998 (A) shows similar protein distribution across tissues to independent antibody HPA019146 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows distinct cytoplasmic positivity with granular pattern in tubular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human heart muscle shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-UQCRC2 antibody HPA007998.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-UQCRC2 antibody HPA007998.
- Sample type
- HUMAN
