HPA007998

UQCRC2 antibody from MilliporeSigma / Merck KGaA
QCR2, UQCR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007998
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007998, RRID:AB_1858648
Product name
Anti-UQCRC2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007998
Antibody type
Polyclonal
Antigen
Cytochrome b-c1 complex subunit 2, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKI
TRGIEAVGGKLSVTATRENMAYTVECLRGDVDILM
EFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNP
QTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEE
LHYFVQN
Storage
-20C
Provider Type Product Number
- No reagents -