HPA019146

UQCRC2 antibody from Sigma-Aldrich
QCR2, UQCR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019146
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019146, RRID:AB_1858649
Product name
Anti-UQCRC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019146
Antibody type
Polyclonal
Antigen
Cytochrome b-c1 complex subunit 2, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQN
GDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGP
HVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSD
SGLFGIYTISQATAAGDVIKAA
Storage
-20C
Provider Type Product Number
- No reagents -