HPA019146

UQCRC2 antibody from Atlas Antibodies
QCR2, UQCR2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019146
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019146, RRID:AB_1858649
Product name
Anti-UQCRC2
Provider product page
Atlas Antibodies - HPA019146
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQN
GDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGP
HVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSD
SGLFGIYTISQATAAGDVIKAA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -