Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004248-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004248-M01, RRID:AB_509265
- Product name
- MGAT3 monoclonal antibody (M01), clone 2G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MGAT3.
- Antigen sequence
LVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFD
GTQQEYPPADPSEHMYAPKYLLKNYDRFHYLLDNP
YQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV- Isotype
- IgG
- Antibody clone number
- 2G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MGAT3 expression in transfected 293T cell line by MGAT3 monoclonal antibody (M01), clone 2G4.Lane 1: MGAT3 transfected lysate (Predicted MW: 61.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of MGAT3 transfected lysate using anti-MGAT3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MGAT3 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol