HPA023693

MMP16 antibody from Atlas Antibodies
C8orf57, DKFZp761D112, MT3-MMP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023693
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023693, RRID:AB_1854025
Product name
Anti-MMP16
Provider product page
Atlas Antibodies - HPA023693
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKT
YFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPES
PQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGY
PRSILKDFMGCD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -