Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406695 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glucagon-Like Peptide 2 Receptor (GLP2R) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GLP2R antibody: synthetic peptide directed towards the N terminal of human GLP2R
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSP
LSFHR KCSLWAPGRP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Naturally occurring glucagon-like peptide-2 (GLP-2) receptors in human intestinal cell lines.
alpha-Adrenergic modulation of hypothalamic self-stimulation: effects of phenoxybenzamine, yohimbine, dexamphetamine and their interactions with clonidine.
Sams A, Hastrup S, Andersen M, Thim L
European journal of pharmacology 2006 Feb 17;532(1-2):18-23
European journal of pharmacology 2006 Feb 17;532(1-2):18-23
alpha-Adrenergic modulation of hypothalamic self-stimulation: effects of phenoxybenzamine, yohimbine, dexamphetamine and their interactions with clonidine.
Hunt GE, Atrens DM, Becker FT, Paxinos G
European journal of pharmacology 1978 Dec 15;53(1):1-8
European journal of pharmacology 1978 Dec 15;53(1):1-8
No comments: Submit comment
No validations: Submit validation data