HPA002966

MTERF3 antibody from Sigma-Aldrich
CGI-12, FLJ10939, MTERFD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002966
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002966, RRID:AB_2147359
Product name
Anti-MTERFD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002966
Antibody type
Polyclonal
Antigen
mTERF domain-containing protein 1, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FKTYRTSSLWNSSQSTSSSSQENNSAQSSLLPSMN
EQSQKTQNISSFDSELFLEELDELPPLSPMQPISE
EEAIQIIADPPLPPASFTLRDYVDHSETLQKLVLL
GVDLSKIEKHPEAANLLLRLDFEKDIKQMLLFLK
Storage
-20C
Provider Type Product Number
- No reagents -