Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310818 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transmembrane Protease, serine 11D (TMPRSS11D) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TMPRSS11D antibody: synthetic peptide directed towards the N terminal of human TMPRSS11D
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLIT
KTFKE SNLRNQFIRA- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human airway trypsin-like protease stimulates human bronchial fibroblast proliferation in a protease-activated receptor-2-dependent pathway.
Matsushima R, Takahashi A, Nakaya Y, Maezawa H, Miki M, Nakamura Y, Ohgushi F, Yasuoka S
American journal of physiology. Lung cellular and molecular physiology 2006 Feb;290(2):L385-95
American journal of physiology. Lung cellular and molecular physiology 2006 Feb;290(2):L385-95
No comments: Submit comment
No validations: Submit validation data