Antibody data

Product number
ABIN310278
Provider
antibodies-online
Product name
anti-Semenogelin I (SEMG1) antibody
Provider product page
antibodies-online - ABIN310278
Antibody type
Polyclonal
Antigen
The immunogen for anti-SEMG1 antibody: synthetic peptide directed towards the N terminal of human SEMG1
Reactivity
Human
Host
Rabbit
Antigen sequence
QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQY
DLNAL HKTTKSQRHL
Vial size
0.1 mg
Provider Type Product Number
- No reagents -