Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ARP51150_P050 - Provider product page
- Provider
- Aviva Systems Biology
- Proper citation
- Aviva Systems Biology Cat#ARP51150_P050, RRID:AB_10713803
- Product name
- Anti-TBC1D24
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide
- Description
- This is a rabbit polyclonal antibody against TBC1D24. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment; please inquire (info@avivasysbio.com).
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
Antigen corresponding to the follow
ing peptide sequence: SDPADRLSPFLAA
RHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDG
DL- Isotype
- IgG
- Vial size
- 50ug
- Concentration
- 1 mg/ml
- Handling
- Add 50 μl of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage; store at -20°C. Avoid repeat freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Aviva Systems Biology (provider)
- Main image
- Experimental details
- Western blot analysis using Anti-LOC643159 antibody detects protein at predicted molecular weight using Jurkat Cells as a positive control. Tissue/Lysate Concentration: 1ug/ml Antibody Concentration: 1.0ug/ml
- Sample type
- Jurkat Cells
- Validation comment
- Western blot analysis detects protein at predicted molecular weight
- Primary Ab dilution
- 1.0ug/ml
- Other comments
- Lysate concentration 1ug/ml