Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000468-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000468-M01, RRID:AB_605956
- Product name
- ATF4 monoclonal antibody (M01), clone 2B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ATF4.
- Antigen sequence
SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIP
QCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRG
SPNRSLPSPGVLCGSARPKPYDPPGEKMVA- Isotype
- IgG
- Antibody clone number
- 2B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Decreased vitamin B12 availability induces ER stress through impaired SIRT1-deacetylation of HSF1.
A protective role of heme-regulated eIF2α kinase in cadmium-induced toxicity in erythroid cells.
Heme-regulated eIF2α kinase activated Atf4 signaling pathway in oxidative stress and erythropoiesis.
12/15-Lipoxygenase signaling in the endoplasmic reticulum stress response.
Calcium channel blocker verapamil enhances endoplasmic reticulum stress and cell death induced by proteasome inhibition in myeloma cells.
Ghemrawi R, Pooya S, Lorentz S, Gauchotte G, Arnold C, Gueant JL, Battaglia-Hsu SF
Cell death & disease 2013 Mar 21;4:e553
Cell death & disease 2013 Mar 21;4:e553
A protective role of heme-regulated eIF2α kinase in cadmium-induced toxicity in erythroid cells.
Wang L, Wang X, Zhang S, Qu G, Liu S
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association 2013 Dec;62:880-91
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association 2013 Dec;62:880-91
Heme-regulated eIF2α kinase activated Atf4 signaling pathway in oxidative stress and erythropoiesis.
Suragani RN, Zachariah RS, Velazquez JG, Liu S, Sun CW, Townes TM, Chen JJ
Blood 2012 May 31;119(22):5276-84
Blood 2012 May 31;119(22):5276-84
12/15-Lipoxygenase signaling in the endoplasmic reticulum stress response.
Cole BK, Kuhn NS, Green-Mitchell SM, Leone KA, Raab RM, Nadler JL, Chakrabarti SK
American journal of physiology. Endocrinology and metabolism 2012 Mar 15;302(6):E654-65
American journal of physiology. Endocrinology and metabolism 2012 Mar 15;302(6):E654-65
Calcium channel blocker verapamil enhances endoplasmic reticulum stress and cell death induced by proteasome inhibition in myeloma cells.
Meister S, Frey B, Lang VR, Gaipl US, Schett G, Schlötzer-Schrehardt U, Voll RE
Neoplasia (New York, N.Y.) 2010 Jul;12(7):550-61
Neoplasia (New York, N.Y.) 2010 Jul;12(7):550-61
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ATF4 expression in transfected 293T cell line by ATF4 monoclonal antibody (M01), clone 2B3.Lane 1: ATF4 transfected lysate(38.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ATF4 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ATF4 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol