HPA003884

NDUFS4 antibody from Sigma-Aldrich
AQDQ, CI-18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003884
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003884, RRID:AB_1079465
Product name
Anti-NDUFS4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003884
Antibody type
Polyclonal
Antigen
NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGV
PEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFD
TRERWENPLMGWASTADPLSNMVLTFSTKEDAVSF
AEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRV
S
Storage
-20C
Provider Type Product Number
- No reagents -