Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008767-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008767-M05, RRID:AB_535009
- Product name
- RIPK2 monoclonal antibody (M05), clone 7F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RIPK2.
- Antigen sequence
LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLS
RDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEE
FAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLL
QNKSM- Isotype
- IgG
- Antibody clone number
- 7F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A proteomic analysis of C-reactive protein stimulated THP-1 monocytes.
Eisenhardt SU, Habersberger J, Oliva K, Lancaster GI, Ayhan M, Woollard KJ, Bannasch H, Rice GE, Peter K
Proteome science 2011 Jan 10;9(1):1
Proteome science 2011 Jan 10;9(1):1
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RIPK2 monoclonal antibody (M05), clone 7F5 Western Blot analysis of RIPK2 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RIPK2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RIPK2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol