ABIN504581

RIPK2 antibody from antibodies-online
CARD3, CARDIAK, RICK, RIP2

Antibody data

Product number
ABIN504581
Provider
antibodies-online
Product name
anti-Receptor-Interacting Serine-threonine Kinase 2 (RIPK2) (Middle Region) antibody
Provider product page
antibodies-online - ABIN504581
Antibody type
Polyclonal
Antigen
The immunogen for anti-RIPK2 antibody: synthetic peptide directed towards the middle region of human RIPK2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
Host
Rabbit
Antigen sequence
LRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYV
WLQHT LRKKLILSYT
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -