HPA015273

RIPK2 antibody from Sigma-Aldrich
CARD3, CARDIAK, RICK, RIP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015273
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015273, RRID:AB_1856299
Product name
Anti-RIPK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015273
Antibody type
Polyclonal
Antigen
Receptor-interacting serine/threonine-protein kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTI
SGSQRAAFCDHKTTPCSSAIINPLSTAGNSERLQP
GIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDL
IMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAK
VI
Storage
-20C
Provider Type Product Number
- No reagents -