HPA019800

ENTHD1 antibody from Sigma-Aldrich
FLJ25421
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019800
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019800, RRID:AB_1848842
Product name
Anti-ENTHD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019800
Antibody type
Polyclonal
Antigen
ENTH domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHISSSHWGEFSTQNVDQFIPLSCSGFQSTKDFPQ
EPEAKNSISVLLREVKRAIARLHEDLSTVIQELNV
INNILMSMSLNSSQISQSSQVP
Storage
-20C
Provider Type Product Number
- No reagents -