Antibody data

Product number
H00005957-M42
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005957-M42, RRID:AB_1137415
Product name
RCV1 monoclonal antibody (M42), clone 3H1
Provider product page
Abnova Corporation - H00005957-M42
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RCV1.
Antigen sequence
HMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEI
VMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFG
KNDDDKLTEKEFIEGTLANKE
Isotype
IgG
Antibody clone number
3H1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -