Antibody data

Product number
H00005957-M37
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005957-M37, RRID:AB_1137006
Product name
RCV1 monoclonal antibody (M37), clone 3F6
Provider product page
Abnova Corporation - H00005957-M37
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RCV1.
Antigen sequence
MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSF
LKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVF
RSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWA
FSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKL
LPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEG
TLANKEILRLIQFEPQKVKEKMKNA
Isotype
IgG
Antibody clone number
3F6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -