HPA003178

KTN1 antibody from Sigma-Aldrich
CG1, KIAA0004, KNT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003178
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003178, RRID:AB_1079218
Product name
Anti-KTN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003178
Antibody type
Polyclonal
Antigen
Kinectin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETLMVPSKRQEALPLHQETKQESGSGKKKASSKKQ
KTENVFVDEPLIHATTYIPLMDNADSSPVVDKREV
IDLLKPDQVEGIQKSGTKKLKTETDKENAEVKFKD
FLLSLKTMMFSEDEALCVVDLLKEKSGVIQ
Storage
-20C
Provider Type Product Number
- No reagents -