HPA006366

POLRMT antibody from Atlas Antibodies
APOLMT, h-mtRPOL, MTRNAP, MTRPOL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006366
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006366, RRID:AB_1079654
Product name
Anti-POLRMT
Provider product page
Atlas Antibodies - HPA006366
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDA
GTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVL
KAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGR
VSYPKLHLPLKTLQCLFEKQLH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -