HPA006366

POLRMT antibody from Sigma-Aldrich
APOLMT, h-mtRPOL, MTRNAP, MTRPOL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006366
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006366, RRID:AB_1079654
Product name
Anti-POLRMT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006366
Antibody type
Polyclonal
Antigen
DNA-directed RNA polymerase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDA
GTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVL
KAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGR
VSYPKLHLPLKTLQCLFEKQLH
Storage
-20C
Provider Type Product Number
- No reagents -